Recombinant Human ADAM30 Protein, GST-tagged
| Cat.No. : | ADAM30-287H |
| Product Overview : | Human ADAM30 partial ORF ( NP_068566, 199 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAM30 ADAM metallopeptidase domain 30 [ Homo sapiens ] |
| Official Symbol | ADAM30 |
| Synonyms | ADAM30; ADAM metallopeptidase domain 30; a disintegrin and metalloproteinase domain 30; disintegrin and metalloproteinase domain-containing protein 30; svph4; |
| Gene ID | 11085 |
| mRNA Refseq | NM_021794 |
| Protein Refseq | NP_068566 |
| MIM | 604779 |
| UniProt ID | Q9UKF2 |
| ◆ Recombinant Proteins | ||
| ADAM30-286H | Recombinant Human ADAM30 Protein, GST-tagged | +Inquiry |
| ADAM30-885HF | Recombinant Full Length Human ADAM30 Protein, GST-tagged | +Inquiry |
| ADAM30-1422H | Recombinant Human ADAM30 protein, GST-tagged | +Inquiry |
| ADAM30-2736H | Recombinant Human ADAM30 protein, His-tagged | +Inquiry |
| ADAM30-287H | Recombinant Human ADAM30 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAM30-9035HCL | Recombinant Human ADAM30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM30 Products
Required fields are marked with *
My Review for All ADAM30 Products
Required fields are marked with *
