Recombinant Human ADAM30 Protein, GST-tagged
| Cat.No. : | ADAM30-287H | 
| Product Overview : | Human ADAM30 partial ORF ( NP_068566, 199 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 36.74 kDa | 
| AA Sequence : | YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ADAM30 ADAM metallopeptidase domain 30 [ Homo sapiens ] | 
| Official Symbol | ADAM30 | 
| Synonyms | ADAM30; ADAM metallopeptidase domain 30; a disintegrin and metalloproteinase domain 30; disintegrin and metalloproteinase domain-containing protein 30; svph4; | 
| Gene ID | 11085 | 
| mRNA Refseq | NM_021794 | 
| Protein Refseq | NP_068566 | 
| MIM | 604779 | 
| UniProt ID | Q9UKF2 | 
| ◆ Recombinant Proteins | ||
| ADAM30-885HF | Recombinant Full Length Human ADAM30 Protein, GST-tagged | +Inquiry | 
| ADAM30-1422H | Recombinant Human ADAM30 protein, GST-tagged | +Inquiry | 
| ADAM30-286H | Recombinant Human ADAM30 Protein, GST-tagged | +Inquiry | 
| ADAM30-2736H | Recombinant Human ADAM30 protein, His-tagged | +Inquiry | 
| ADAM30-287H | Recombinant Human ADAM30 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ADAM30-9035HCL | Recombinant Human ADAM30 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM30 Products
Required fields are marked with *
My Review for All ADAM30 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            