Recombinant Human ADAM32 protein, GST-tagged
Cat.No. : | ADAM32-3451H |
Product Overview : | Recombinant Human ADAM32 protein(704-787 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 704-787 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | RKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN |
Gene Name | ADAM32 ADAM metallopeptidase domain 32 [ Homo sapiens ] |
Official Symbol | ADAM32 |
Synonyms | ADAM32; ADAM metallopeptidase domain 32; a disintegrin and metalloproteinase domain 32; disintegrin and metalloproteinase domain-containing protein 32; ADAM 32; metalloproteinase 12-like protein; a disintegrin and metalloprotease domain 32; FLJ26299; FLJ29004; |
Gene ID | 203102 |
mRNA Refseq | NM_145004 |
Protein Refseq | NP_659441 |
UniProt ID | Q8TC27 |
◆ Recombinant Proteins | ||
ADAM32-3835H | Recombinant Human ADAM32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADAM32-1296M | Recombinant Mouse ADAM32 Protein | +Inquiry |
ADAM32-288H | Recombinant Human ADAM32 Protein, GST-tagged | +Inquiry |
ADAM32-317M | Recombinant Mouse ADAM32 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM32-3451H | Recombinant Human ADAM32 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM32-9034HCL | Recombinant Human ADAM32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM32 Products
Required fields are marked with *
My Review for All ADAM32 Products
Required fields are marked with *