Recombinant Human ADAM33 Protein, GST-tagged

Cat.No. : ADAM33-289H
Product Overview : Human ADAM33 full-length ORF ( AAH62663.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
Molecular Mass : 35.8 kDa
AA Sequence : MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAM33 ADAM metallopeptidase domain 33 [ Homo sapiens ]
Official Symbol ADAM33
Synonyms ADAM33; ADAM metallopeptidase domain 33; a disintegrin and metalloproteinase domain 33 , C20orf153, chromosome 20 open reading frame 153; disintegrin and metalloproteinase domain-containing protein 33; dJ964F7.1; DKFZp434K0521; ADAM 33; a disintegrin and metalloprotease 33; a disintegrin and metalloproteinase domain 33; disintegrin and reprolysin metalloproteinase family protein; C20orf153; DJ964F7.1; FLJ35308; FLJ36751; MGC71889; MGC149823;
Gene ID 80332
mRNA Refseq NM_025220
Protein Refseq NP_079496
MIM 607114
UniProt ID Q9BZ11

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAM33 Products

Required fields are marked with *

My Review for All ADAM33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon