Recombinant Human ADAM33 Protein, GST-tagged
Cat.No. : | ADAM33-289H |
Product Overview : | Human ADAM33 full-length ORF ( AAH62663.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAM33 ADAM metallopeptidase domain 33 [ Homo sapiens ] |
Official Symbol | ADAM33 |
Synonyms | ADAM33; ADAM metallopeptidase domain 33; a disintegrin and metalloproteinase domain 33 , C20orf153, chromosome 20 open reading frame 153; disintegrin and metalloproteinase domain-containing protein 33; dJ964F7.1; DKFZp434K0521; ADAM 33; a disintegrin and metalloprotease 33; a disintegrin and metalloproteinase domain 33; disintegrin and reprolysin metalloproteinase family protein; C20orf153; DJ964F7.1; FLJ35308; FLJ36751; MGC71889; MGC149823; |
Gene ID | 80332 |
mRNA Refseq | NM_025220 |
Protein Refseq | NP_079496 |
MIM | 607114 |
UniProt ID | Q9BZ11 |
◆ Recombinant Proteins | ||
ADAM33-1484H | Recombinant Human ADAM33 protein, His & T7-tagged | +Inquiry |
ADAM33-290H | Recombinant Human ADAM33 Protein, GST-tagged | +Inquiry |
ADAM33-887HF | Recombinant Full Length Human ADAM33 Protein, GST-tagged | +Inquiry |
ADAM33-38485H | Recombinant Human ADAM33 protein(30-701aa), His-tagged | +Inquiry |
ADAM33-2885H | Recombinant Human ADAM33 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM33-9033HCL | Recombinant Human ADAM33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM33 Products
Required fields are marked with *
My Review for All ADAM33 Products
Required fields are marked with *