Recombinant Human ADAMTS3 Protein, GST-tagged

• Cat.No.: ADAMTS3-305H
• Product Overview: Human ADAMTS3 partial ORF ( NP_055058.1, 1048 a.a. - 1128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease, a member of the procollagen aminopropeptidase subfamily of proteins, may play a role in the processing of type II fibrillar collagen in articular cartilage. [provided by RefSeq, Feb 2016]
• Molecular Mass: 34.65 kDa
• AA Sequence: ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS3 ADAM metallopeptidase with thrombospondin type 1 motif, 3 [ Homo sapiens ]
• Official Symbol: ADAMTS3
• Synonyms: ADAMTS3; ADAM metallopeptidase with thrombospondin type 1 motif, 3; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3; A disintegrin and metalloproteinase with thrombospondin motifs 3; ADAMTS 4; KIAA0366; ADAM-TS3; ADAMTS-3; PC II-NP; ADAM-TS 3; zinc metalloendopeptidase; procollagen II N-proteinase; procollagen II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3; ADAMTS-4
• Gene ID: 9508
• mRNA Refseq: NM_014243
• Protein Refseq: NP_055058
• MIM: 605011
• UniProt ID: O15072