Recombinant Human ADAMTS3 Protein, GST-tagged
Cat.No. : | ADAMTS3-305H |
Product Overview : | Human ADAMTS3 partial ORF ( NP_055058.1, 1048 a.a. - 1128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease, a member of the procollagen aminopropeptidase subfamily of proteins, may play a role in the processing of type II fibrillar collagen in articular cartilage. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 34.65 kDa |
AA Sequence : | ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTS3 ADAM metallopeptidase with thrombospondin type 1 motif, 3 [ Homo sapiens ] |
Official Symbol | ADAMTS3 |
Synonyms | ADAMTS3; ADAM metallopeptidase with thrombospondin type 1 motif, 3; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3; A disintegrin and metalloproteinase with thrombospondin motifs 3; ADAMTS 4; KIAA0366; ADAM-TS3; ADAMTS-3; PC II-NP; ADAM-TS 3; zinc metalloendopeptidase; procollagen II N-proteinase; procollagen II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3; ADAMTS-4; |
Gene ID | 9508 |
mRNA Refseq | NM_014243 |
Protein Refseq | NP_055058 |
MIM | 605011 |
UniProt ID | O15072 |
◆ Recombinant Proteins | ||
ADAMTS3-736H | Recombinant Human ADAMTS3 | +Inquiry |
ADAMTS3-1965H | Recombinant Human ADAMTS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADAMTS3-9389H | Recombinant Human ADAMTS3, His-tagged | +Inquiry |
ADAMTS3-3015H | Recombinant Human ADAMTS3, His-tagged | +Inquiry |
Adamts3-1529M | Recombinant Mouse Adamts3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS3-9030HCL | Recombinant Human ADAMTS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS3 Products
Required fields are marked with *
My Review for All ADAMTS3 Products
Required fields are marked with *
0
Inquiry Basket