Recombinant Human ADAMTS5 protein, His-tagged
Cat.No. : | ADAMTS5-3533H |
Product Overview : | Recombinant Human ADAMTS5 protein(417-558 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 417-558 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GLSHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTK |
Gene Name | ADAMTS5 ADAM metallopeptidase with thrombospondin type 1 motif, 5 [ Homo sapiens ] |
Official Symbol | ADAMTS5 |
Synonyms | ADAMTS5; ADAM metallopeptidase with thrombospondin type 1 motif, 5; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase 2); A disintegrin and metalloproteinase with thrombospondin motifs 5; ADAMTS11; ADMP 2; aggrecanase 2; aggrecanase-2; a disintegrin and metalloproteinase with thrombospondin motifs 11; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2); ADMP-2; ADAM-TS5; ADAMTS-5; ADAM-TS 5; ADAMTS-11; ADAM-TS 11; |
Gene ID | 11096 |
mRNA Refseq | NM_007038 |
Protein Refseq | NP_008969 |
MIM | 605007 |
UniProt ID | Q9UNA0 |
◆ Recombinant Proteins | ||
ADAMTS5-535H | Recombinant Human ADAMTS5 | +Inquiry |
ADAMTS5-3533H | Recombinant Human ADAMTS5 protein, His-tagged | +Inquiry |
ADAMTS5-1755H | Recombinant Human ADAMTS5 protein, His & T7-tagged | +Inquiry |
ADAMTS5-307H | Recombinant Human ADAMTS5 Protein, GST-tagged | +Inquiry |
ADAMTS5-534H | Active Recombinant Human ADAMTS5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS5-9028HCL | Recombinant Human ADAMTS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS5 Products
Required fields are marked with *
My Review for All ADAMTS5 Products
Required fields are marked with *