Recombinant Human ADAMTS6 Protein, GST-tagged

Cat.No. : ADAMTS6-308H
Product Overview : Human ADAMTS6 partial ORF ( NP_922932.2, 725 a.a. - 824 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Expression of this gene may be regulated by the cytokine TNF-alpha. [provided by RefSeq, Mar 2016]
Molecular Mass : 36.74 kDa
AA Sequence : DSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTS6 ADAM metallopeptidase with thrombospondin type 1 motif, 6 [ Homo sapiens ]
Official Symbol ADAMTS6
Synonyms ADAMTS6; ADAM metallopeptidase with thrombospondin type 1 motif, 6; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; A disintegrin and metalloproteinase with thrombospondin motifs 6; a disintegrin and metalloproteinase with thrombospondin motifs 6; ADAM TS6; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; ADAM-TS6; ADAMTS-6; ADAM-TS 6;
Gene ID 11174
mRNA Refseq NM_197941
Protein Refseq NP_922932
MIM 605008
UniProt ID Q9UKP5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS6 Products

Required fields are marked with *

My Review for All ADAMTS6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon