Recombinant Human ADAMTS6 Protein, GST-tagged
| Cat.No. : | ADAMTS6-308H |
| Product Overview : | Human ADAMTS6 partial ORF ( NP_922932.2, 725 a.a. - 824 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Expression of this gene may be regulated by the cytokine TNF-alpha. [provided by RefSeq, Mar 2016] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | DSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAMTS6 ADAM metallopeptidase with thrombospondin type 1 motif, 6 [ Homo sapiens ] |
| Official Symbol | ADAMTS6 |
| Synonyms | ADAMTS6; ADAM metallopeptidase with thrombospondin type 1 motif, 6; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; A disintegrin and metalloproteinase with thrombospondin motifs 6; a disintegrin and metalloproteinase with thrombospondin motifs 6; ADAM TS6; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; ADAM-TS6; ADAMTS-6; ADAM-TS 6; |
| Gene ID | 11174 |
| mRNA Refseq | NM_197941 |
| Protein Refseq | NP_922932 |
| MIM | 605008 |
| UniProt ID | Q9UKP5 |
| ◆ Recombinant Proteins | ||
| ADAMTS6-308H | Recombinant Human ADAMTS6 Protein, GST-tagged | +Inquiry |
| ADAMTS6-2955H | Recombinant Human ADAMTS6 protein, GST-tagged | +Inquiry |
| ADAMTS6-2954H | Recombinant Human ADAMTS6 protein, His-tagged | +Inquiry |
| Adamts6-368M | Recombinant Mouse Adamts6 Protein, MYC/DDK-tagged | +Inquiry |
| ADAMTS6-1148H | Recombinant Human ADAMTS6 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS6 Products
Required fields are marked with *
My Review for All ADAMTS6 Products
Required fields are marked with *
