Recombinant Human ADAMTSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ADAMTSL1-5240H |
Product Overview : | ADAMTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_443098) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. |
Molecular Mass : | 55.3 kDa |
AA Sequence : | MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLNSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ADAMTSL1 ADAMTS-like 1 [ Homo sapiens (human) ] |
Official Symbol | ADAMTSL1 |
Synonyms | ADAMTSL1; ADAMTS-like 1; C9orf94, chromosome 9 open reading frame 94; ADAMTS-like protein 1; ADAMTSR1; FLJ35283; punctin; punctin-1; ADAM-TS related protein 1; C9orf94; PUNCTIN; ADAMTSL-1; FLJ41032; FLJ46891; MGC40193; MGC118803; MGC118805; DKFZp686L03130; |
Gene ID | 92949 |
mRNA Refseq | NM_052866 |
Protein Refseq | NP_443098 |
MIM | 609198 |
UniProt ID | Q8N6G6 |
◆ Recombinant Proteins | ||
ADAMTSL1-919HF | Recombinant Full Length Human ADAMTSL1 Protein, GST-tagged | +Inquiry |
ADAMTSL1-311H | Recombinant Human ADAMTSL1 Protein, GST-tagged | +Inquiry |
ADAMTSL1-7361H | Recombinant Human ADAMTSL1 protein, His-tagged | +Inquiry |
ADAMTSL1-5312H | Recombinant Human ADAMTSL1 Protein (Met1-Lys439), C-His tagged | +Inquiry |
Adamtsl1-1532M | Recombinant Mouse Adamtsl1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTSL1-001HCL | Recombinant Human ADAMTSL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTSL1 Products
Required fields are marked with *
My Review for All ADAMTSL1 Products
Required fields are marked with *
0
Inquiry Basket