Recombinant Human ADAMTSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ADAMTSL1-5240H
• Product Overview: ADAMTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_443098) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins.
• Molecular Mass: 55.3 kDa
• AA Sequence: MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLNSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ADAMTSL1 ADAMTS-like 1 [ Homo sapiens (human) ]
• Official Symbol: ADAMTSL1
• Synonyms: ADAMTSL1; ADAMTS-like 1; C9orf94, chromosome 9 open reading frame 94; ADAMTS-like protein 1; ADAMTSR1; FLJ35283; punctin; punctin-1; ADAM-TS related protein 1; C9orf94; PUNCTIN; ADAMTSL-1; FLJ41032; FLJ46891; MGC40193; MGC118803; MGC118805; DKFZp686L03130
• Gene ID: 92949
• mRNA Refseq: NM_052866
• Protein Refseq: NP_443098
• MIM: 609198
• UniProt ID: Q8N6G6