Recombinant Human ADAR protein, GST-tagged ADAR-529H

Recombinant Human ADAR protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ADAR protein, GST-tagged

Recombinant Human ADAR protein, GST-tagged

ADAR Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADAR-529H
Product Overview : Recombinant Human ADAR(2 a.a. - 110 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : NPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFP VLLASSTRGRQVDIRGVPRGVHLGSQGLQRGFQH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : ADAR adenosine deaminase, RNA-specific [ Homo sapiens ]
Official Symbol : ADAR
Synonyms : ADAR; adenosine deaminase, RNA-specific; G1P1, IFI4, interferon induced protein 4; double-stranded RNA-specific adenosine deaminase; ADAR1; dsRNA adenosine deaminase; interferon-induced protein 4; interferon-inducible protein 4; adenosine deaminase acting on RNA 1-A; 136 kDa double-stranded RNA-binding protein; DSH; G1P1; IFI4; P136; DRADA; DSRAD; IFI-4; K88DSRBP;
Gene ID : 103
mRNA Refseq : NM_001111
Protein Refseq : NP_001102
MIM : 146920
UniProt ID : P55265
Chromosome Location : 1q21.3
Pathway : C6 deamination of adenosine, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Formation of editosomes by ADAR proteins, organism-specific biosystem; Gene Expression, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : DNA binding; double-stranded RNA adenosine deaminase activity; double-stranded RNA adenosine deaminase activity; double-stranded RNA binding; hydrolase activity; metal ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy