Recombinant Human ADAR protein, His-SUMO-tagged

• Cat.No.: ADAR-2484H
• Product Overview: Recombinant Human ADAR protein(P55265)(1-176aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-176aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.6 kDa
• AA Sequence: MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ADAR adenosine deaminase, RNA-specific [ Homo sapiens ]
• Official Symbol: ADAR
• Synonyms: ADAR; adenosine deaminase, RNA-specific; G1P1, IFI4, interferon induced protein 4; double-stranded RNA-specific adenosine deaminase; ADAR1; dsRNA adenosine deaminase; interferon-induced protein 4; interferon-inducible protein 4; adenosine deaminase acting on RNA 1-A; 136 kDa double-stranded RNA-binding protein; DSH; G1P1; IFI4; P136; DRADA; DSRAD; IFI-4; K88DSRBP
• Gene ID: 103
• mRNA Refseq: NM_001025107
• Protein Refseq: NP_001020278
• MIM: 146920
• UniProt ID: P55265