Recombinant Human ADAT1 Protein, GST-tagged
| Cat.No. : | ADAT1-317H |
| Product Overview : | Human ADAT1 full-length ORF ( AAH02758.1, 1 a.a. - 502 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010] |
| Molecular Mass : | 81.8 kDa |
| AA Sequence : | MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQFK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAT1 adenosine deaminase, tRNA-specific 1 [ Homo sapiens ] |
| Official Symbol | ADAT1 |
| Synonyms | ADAT1; adenosine deaminase, tRNA-specific 1; tRNA-specific adenosine deaminase 1; adenosine deaminase acting on tRNA; tRNA-specific adenosine-37 deaminase; HADAT1; |
| Gene ID | 23536 |
| mRNA Refseq | NM_012091 |
| Protein Refseq | NP_036223 |
| MIM | 604230 |
| UniProt ID | Q9BUB4 |
| ◆ Recombinant Proteins | ||
| ADAT1-1333M | Recombinant Mouse ADAT1 Protein | +Inquiry |
| ADAT1-237R | Recombinant Rhesus monkey ADAT1 Protein, His-tagged | +Inquiry |
| ADAT1-317H | Recombinant Human ADAT1 Protein, GST-tagged | +Inquiry |
| ADAT1-278C | Recombinant Cynomolgus ADAT1 Protein, His-tagged | +Inquiry |
| ADAT1-1143H | Recombinant Human ADAT1 Protein, GST/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAT1-9024HCL | Recombinant Human ADAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAT1 Products
Required fields are marked with *
My Review for All ADAT1 Products
Required fields are marked with *



