Recombinant Human ADAT1 Protein, GST-tagged
Cat.No. : | ADAT1-317H |
Product Overview : | Human ADAT1 full-length ORF ( AAH02758.1, 1 a.a. - 502 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010] |
Molecular Mass : | 81.8 kDa |
AA Sequence : | MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAT1 adenosine deaminase, tRNA-specific 1 [ Homo sapiens ] |
Official Symbol | ADAT1 |
Synonyms | ADAT1; adenosine deaminase, tRNA-specific 1; tRNA-specific adenosine deaminase 1; adenosine deaminase acting on tRNA; tRNA-specific adenosine-37 deaminase; HADAT1; |
Gene ID | 23536 |
mRNA Refseq | NM_012091 |
Protein Refseq | NP_036223 |
MIM | 604230 |
UniProt ID | Q9BUB4 |
◆ Recombinant Proteins | ||
ADAT1-2008C | Recombinant Chicken ADAT1 | +Inquiry |
ADAT1-28H | Recombinant Human ADAT1, T7-tagged | +Inquiry |
ADAT1-3157H | Recombinant Homo sapiens ADAT1 | +Inquiry |
ADAT1-1333M | Recombinant Mouse ADAT1 Protein | +Inquiry |
ADAT1-278C | Recombinant Cynomolgus ADAT1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAT1-9024HCL | Recombinant Human ADAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAT1 Products
Required fields are marked with *
My Review for All ADAT1 Products
Required fields are marked with *