Recombinant Human ADAT3 Protein, GST-tagged
Cat.No. : | ADAT3-318H |
Product Overview : | Human ADAT3 full-length ORF ( NP_612431.1, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of a tRNA-specific adenosine deaminase. This heterodimeric enzyme converts adenosine to inosine in the tRNA anticodon. A mutation in this gene causes a syndrome characterized by intellectual disability and strabismus. This gene shares its 5' exon with the overlapping gene, secretory carrier membrane protein 4 (Gene ID: 113178). [provided by RefSeq, Jul 2016] |
Molecular Mass : | 64.5 kDa |
AA Sequence : | MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAT3 adenosine deaminase, tRNA-specific 3 [ Homo sapiens ] |
Official Symbol | ADAT3 |
Synonyms | ADAT3; adenosine deaminase, tRNA-specific 3; adenosine deaminase, tRNA specific 3, TAD3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase-like protein 3; TAD3; tRNA specific adenosine deaminase 3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase 3 homolog; adenosine deaminase, tRNA-specific 3, TAD3 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT3; FWP005; MST121; S863-5; MSTP121; |
Gene ID | 113179 |
mRNA Refseq | NM_138422 |
Protein Refseq | NP_612431 |
UniProt ID | Q96EY9 |
◆ Recombinant Proteins | ||
AASDH-6744H | Recombinant Human AASDH protein, His-tagged | +Inquiry |
ADAT3-332M | Recombinant Mouse ADAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAT3-1270H | Recombinant Human ADAT3 | +Inquiry |
ADAT3-513R | Recombinant Rat ADAT3 Protein | +Inquiry |
ADAT3-900HF | Recombinant Full Length Human ADAT3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAT3-996HCL | Recombinant Human ADAT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAT3 Products
Required fields are marked with *
My Review for All ADAT3 Products
Required fields are marked with *
0
Inquiry Basket