Recombinant Human ADAT3 protein, His-tagged
Cat.No. : | ADAT3-2854H |
Product Overview : | Recombinant Human ADAT3 protein(1-351 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-351 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT |
Gene Name | ADAT3 adenosine deaminase, tRNA-specific 3 [ Homo sapiens ] |
Official Symbol | ADAT3 |
Synonyms | ADAT3; adenosine deaminase, tRNA-specific 3; adenosine deaminase, tRNA specific 3, TAD3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase-like protein 3; TAD3; tRNA specific adenosine deaminase 3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase 3 homolog; adenosine deaminase, tRNA-specific 3, TAD3 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT3; FWP005; MST121; S863-5; MSTP121; |
Gene ID | 113179 |
mRNA Refseq | NM_138422 |
Protein Refseq | NP_612431 |
UniProt ID | Q96EY9 |
◆ Recombinant Proteins | ||
ADAT3-169R | Recombinant Rat ADAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAT3-2854H | Recombinant Human ADAT3 protein, His-tagged | +Inquiry |
ADAT3-2428H | Recombinant Human ADAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAT3-332M | Recombinant Mouse ADAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAT3-8457Z | Recombinant Zebrafish ADAT3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAT3-996HCL | Recombinant Human ADAT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAT3 Products
Required fields are marked with *
My Review for All ADAT3 Products
Required fields are marked with *
0
Inquiry Basket