Recombinant Human ADAT3 protein, His-tagged

Cat.No. : ADAT3-2854H
Product Overview : Recombinant Human ADAT3 protein(1-351 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-351 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT
Gene Name ADAT3 adenosine deaminase, tRNA-specific 3 [ Homo sapiens ]
Official Symbol ADAT3
Synonyms ADAT3; adenosine deaminase, tRNA-specific 3; adenosine deaminase, tRNA specific 3, TAD3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase-like protein 3; TAD3; tRNA specific adenosine deaminase 3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase 3 homolog; adenosine deaminase, tRNA-specific 3, TAD3 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT3; FWP005; MST121; S863-5; MSTP121;
Gene ID 113179
mRNA Refseq NM_138422
Protein Refseq NP_612431
UniProt ID Q96EY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAT3 Products

Required fields are marked with *

My Review for All ADAT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon