Recombinant Human ADCK4 protein, His-tagged
Cat.No. : | ADCK4-2421H |
Product Overview : | Recombinant Human ADCK4 protein(195-544 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 195-544 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS |
Gene Name | ADCK4 aarF domain containing kinase 4 [ Homo sapiens ] |
Official Symbol | ADCK4 |
Synonyms | ADCK4; aarF domain containing kinase 4; uncharacterized aarF domain-containing protein kinase 4; COQ8; FLJ12229; |
Gene ID | 79934 |
mRNA Refseq | NM_001142555 |
Protein Refseq | NP_001136027 |
UniProt ID | Q96D53 |
◆ Recombinant Proteins | ||
ADCK4-515R | Recombinant Rat ADCK4 Protein | +Inquiry |
ADCK4-171R | Recombinant Rat ADCK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCK4-68R | Recombinant Rhesus Macaque ADCK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCK4-2421H | Recombinant Human ADCK4 protein, His-tagged | +Inquiry |
ADCK4-240R | Recombinant Rhesus monkey ADCK4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADCK4-9022HCL | Recombinant Human ADCK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCK4 Products
Required fields are marked with *
My Review for All ADCK4 Products
Required fields are marked with *
0
Inquiry Basket