| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    E.coli | 
                                
                                
                                    | Tag : | 
                                    His | 
                                
                                
                                    | Protein Length : | 
                                    195-544 aa | 
                                
                                
                                    | Tag  : | 
                                    N-His | 
                                
                                
                                    | Form : | 
                                    The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
                                
                                
                                    | Purity : | 
                                    85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
                                
                                
                                    | Storage : | 
                                    Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
                                
                                
                                    | Reconstitution : | 
                                    Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. | 
                                
                                
                                    | AA Sequence : | 
                                    LEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS |