Recombinant Human ADCYAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ADCYAP1-4155H |
Product Overview : | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 18.8 kDa |
AA Sequence : | MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ADCYAP1 adenylate cyclase activating polypeptide 1 [ Homo sapiens (human) ] |
Official Symbol | ADCYAP1 |
Synonyms | ADCYAP1; adenylate cyclase activating polypeptide 1 (pituitary); pituitary adenylate cyclase-activating polypeptide; PACAP; MGC126852; |
Gene ID | 116 |
mRNA Refseq | NM_001099733 |
Protein Refseq | NP_001093203 |
MIM | 102980 |
UniProt ID | P18509 |
◆ Recombinant Proteins | ||
ADCYAP1-1078C | Recombinant Chicken ADCYAP1 | +Inquiry |
ADCYAP1-520R | Recombinant Rat ADCYAP1 Protein | +Inquiry |
ADCYAP1-334H | Recombinant Human ADCYAP1 Protein, GST-tagged | +Inquiry |
ADCYAP1-333H | Recombinant Human ADCYAP1 Protein, GST-tagged | +Inquiry |
ADCYAP1-176R | Recombinant Rat ADCYAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADCYAP1-9019HCL | Recombinant Human ADCYAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCYAP1 Products
Required fields are marked with *
My Review for All ADCYAP1 Products
Required fields are marked with *