Recombinant Human ADD2 protein, His-tagged
| Cat.No. : | ADD2-9414H |
| Product Overview : | Recombinant Human ADD2 protein(1-331 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-331 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLIL |
| Gene Name | ADD2 adducin 2 (beta) [ Homo sapiens ] |
| Official Symbol | ADD2 |
| Synonyms | ADD2; adducin 2 (beta); beta-adducin; ADDB; erythrocyte adducin subunit beta; |
| Gene ID | 119 |
| mRNA Refseq | NM_001185054 |
| Protein Refseq | NP_001171983 |
| MIM | 102681 |
| UniProt ID | P35612 |
| ◆ Recombinant Proteins | ||
| ADD2-340M | Recombinant Mouse ADD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADD2-13HF | Recombinant Full Length Human ADD2 Protein | +Inquiry |
| Add2-540M | Recombinant Mouse Add2 Protein, MYC/DDK-tagged | +Inquiry |
| ADD2-6323H | Recombinant Human ADD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ADD2-2935H | Recombinant Human ADD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
| ADD2-9016HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADD2 Products
Required fields are marked with *
My Review for All ADD2 Products
Required fields are marked with *
