Recombinant Human ADD3 Protein, GST-tagged
| Cat.No. : | ADD3-339H |
| Product Overview : | Human ADD3 partial ORF ( NP_058432, 462 a.a. - 560 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced adducin gamma transcripts encoding different isoforms have been described. The functions of the different isoforms are not known. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADD3 adducin 3 (gamma) [ Homo sapiens ] |
| Official Symbol | ADD3 |
| Synonyms | ADDL |
| Gene ID | 120 |
| mRNA Refseq | NM_019903.3 |
| Protein Refseq | NP_063968.1 |
| MIM | 601568 |
| UniProt ID | Q9UEY8 |
| ◆ Recombinant Proteins | ||
| ADD3-1145H | Recombinant Human ADD3 Protein, MYC/DDK-tagged | +Inquiry |
| ADD3-771H | Recombinant Human ADD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ADD3-909HF | Recombinant Full Length Human ADD3 Protein, GST-tagged | +Inquiry |
| ADD3-5679C | Recombinant Chicken ADD3 | +Inquiry |
| ADD3-1352M | Recombinant Mouse ADD3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADD3 Products
Required fields are marked with *
My Review for All ADD3 Products
Required fields are marked with *
