Recombinant Human ADGRG5 protein, T7/His-tagged
| Cat.No. : | ADGRG5-177H |
| Product Overview : | Recombinant human GPR114 extracellular domain cDNA (22 - 250 aa, derived from BC032401) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 22-250 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTL QTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFK DENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQ VLCRCNHLTYFAVLMQLSPALVPAELLAPLTY |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | ADGRG5 adhesion G protein-coupled receptor G5 [ Homo sapiens ] |
| Official Symbol | ADGRG5 |
| Synonyms | PGR27; GPR114; G protein-coupled receptor 114; G protein-coupled receptor PGR27 |
| Gene ID | 221188 |
| mRNA Refseq | NM_001304376 |
| Protein Refseq | NP_001291305 |
| MIM | |
| UniProt ID | Q8IZF4 |
| Chromosome Location | 16q21 |
| Function | G-protein coupled receptor activity |
| ◆ Recombinant Proteins | ||
| RFL23673MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 114(Gpr114) Protein, His-Tagged | +Inquiry |
| RFL26170HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 114(Gpr114) Protein, His-Tagged | +Inquiry |
| ADGRG5-5573HF | Recombinant Full Length Human ADGRG5 Protein | +Inquiry |
| ADGRG5-5174H | Recombinant Human ADGRG5 Protein, GST-tagged | +Inquiry |
| ADGRG5-5173H | Recombinant Human ADGRG5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADGRG5 Products
Required fields are marked with *
My Review for All ADGRG5 Products
Required fields are marked with *
