Recombinant Human ADGRG5 protein, T7/His-tagged
Cat.No. : | ADGRG5-177H |
Product Overview : | Recombinant human GPR114 extracellular domain cDNA (22 - 250 aa, derived from BC032401) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 22-250 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTL QTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFK DENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQ VLCRCNHLTYFAVLMQLSPALVPAELLAPLTY |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | ADGRG5 adhesion G protein-coupled receptor G5 [ Homo sapiens ] |
Official Symbol | ADGRG5 |
Synonyms | PGR27; GPR114; G protein-coupled receptor 114; G protein-coupled receptor PGR27 |
Gene ID | 221188 |
mRNA Refseq | NM_001304376 |
Protein Refseq | NP_001291305 |
MIM | |
UniProt ID | Q8IZF4 |
Chromosome Location | 16q21 |
Function | G-protein coupled receptor activity |
◆ Recombinant Proteins | ||
RFL23673MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 114(Gpr114) Protein, His-Tagged | +Inquiry |
ADGRG5-177H | Recombinant Human ADGRG5 protein, T7/His-tagged | +Inquiry |
ADGRG5-5173H | Recombinant Human ADGRG5 Protein | +Inquiry |
RFL26170HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 114(Gpr114) Protein, His-Tagged | +Inquiry |
ADGRG5-5174H | Recombinant Human ADGRG5 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADGRG5 Products
Required fields are marked with *
My Review for All ADGRG5 Products
Required fields are marked with *