Recombinant Human ADH7, His-tagged

Cat.No. : ADH7-20H
Product Overview : Recombinant Human Alcohol Dehydrogenase Class 4 Mu/Sigma Chain/ADH7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Phe386) of Human ADH7 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-386 a.a.
AA Sequence : MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHV IKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDIT GRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAA VKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK PISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRT WKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFVDHH HHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide [ Homo sapiens ]
Official Symbol ADH7
Synonyms ADH7; alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide; alcohol dehydrogenase class 4 mu/sigma chain; ADH 4; retinol dehydrogenase; alcohol dehydrogenase-7; alcohol dehydrogenase VII; gastric alcohol dehydrogenase; class IV sigma-1 alcohol dehydrogenase; class IV sigmasigma alcohol dehydrogenase; alcohol dehydrogenase class IV mu/sigma chain; ADH4;
Gene ID 131
mRNA Refseq NM_000673
Protein Refseq NP_000664
MIM 600086
UniProt ID P40394
Chromosome Location 4q23-q24
Pathway Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem;
Function alcohol dehydrogenase (NAD) activity; alcohol dehydrogenase activity, zinc-dependent; aldehyde oxidase activity; ethanol binding; metal ion binding; nucleotide binding; oxidoreductase activity; receptor antagonist activity; retinol binding; retinol dehydrogenase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADH7 Products

Required fields are marked with *

My Review for All ADH7 Products

Required fields are marked with *

0
cart-icon