Recombinant Human ADH7, His-tagged
Cat.No. : | ADH7-20H |
Product Overview : | Recombinant Human Alcohol Dehydrogenase Class 4 Mu/Sigma Chain/ADH7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Phe386) of Human ADH7 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-386 a.a. |
AA Sequence : | MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHV IKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDIT GRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAA VKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK PISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRT WKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFVDHH HHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide [ Homo sapiens ] |
Official Symbol | ADH7 |
Synonyms | ADH7; alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide; alcohol dehydrogenase class 4 mu/sigma chain; ADH 4; retinol dehydrogenase; alcohol dehydrogenase-7; alcohol dehydrogenase VII; gastric alcohol dehydrogenase; class IV sigma-1 alcohol dehydrogenase; class IV sigmasigma alcohol dehydrogenase; alcohol dehydrogenase class IV mu/sigma chain; ADH4; |
Gene ID | 131 |
mRNA Refseq | NM_000673 |
Protein Refseq | NP_000664 |
MIM | 600086 |
UniProt ID | P40394 |
Chromosome Location | 4q23-q24 |
Pathway | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; |
Function | alcohol dehydrogenase (NAD) activity; alcohol dehydrogenase activity, zinc-dependent; aldehyde oxidase activity; ethanol binding; metal ion binding; nucleotide binding; oxidoreductase activity; receptor antagonist activity; retinol binding; retinol dehydrogenase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
Adh7-3253R | Recombinant Rat Adh7, His-tagged | +Inquiry |
ADH7-9421H | Recombinant Human ADH7 protein, His-tagged | +Inquiry |
ADH7-3254H | Recombinant Human ADH7, His-tagged | +Inquiry |
ADH7-5336H | Recombinant Human ADH7 protein, His-tagged | +Inquiry |
ADH7-308H | Recombinant Human ADH7 Protein (1-386 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADH7-9012HCL | Recombinant Human ADH7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH7 Products
Required fields are marked with *
My Review for All ADH7 Products
Required fields are marked with *