Recombinant Human ADH7, His-tagged
| Cat.No. : | ADH7-20H |
| Product Overview : | Recombinant Human Alcohol Dehydrogenase Class 4 Mu/Sigma Chain/ADH7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Phe386) of Human ADH7 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-386 a.a. |
| AA Sequence : | MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHV IKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDIT GRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAA VKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK PISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRT WKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFVDHH HHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide [ Homo sapiens ] |
| Official Symbol | ADH7 |
| Synonyms | ADH7; alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide; alcohol dehydrogenase class 4 mu/sigma chain; ADH 4; retinol dehydrogenase; alcohol dehydrogenase-7; alcohol dehydrogenase VII; gastric alcohol dehydrogenase; class IV sigma-1 alcohol dehydrogenase; class IV sigmasigma alcohol dehydrogenase; alcohol dehydrogenase class IV mu/sigma chain; ADH4; |
| Gene ID | 131 |
| mRNA Refseq | NM_000673 |
| Protein Refseq | NP_000664 |
| MIM | 600086 |
| UniProt ID | P40394 |
| Chromosome Location | 4q23-q24 |
| Pathway | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; |
| Function | alcohol dehydrogenase (NAD) activity; alcohol dehydrogenase activity, zinc-dependent; aldehyde oxidase activity; ethanol binding; metal ion binding; nucleotide binding; oxidoreductase activity; receptor antagonist activity; retinol binding; retinol dehydrogenase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| Adh7-542M | Recombinant Mouse Adh7 Protein, MYC/DDK-tagged | +Inquiry |
| ADH7-1357M | Recombinant Mouse ADH7 Protein | +Inquiry |
| ADH7-0573H | Recombinant Human ADH7 Protein (Met1-Phe386 ), C-His-tagged | +Inquiry |
| ADH7-0250H | Recombinant Human ADH7 Protein (G14-F386), Tag Free | +Inquiry |
| Adh7-3253R | Recombinant Rat Adh7, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADH7-9012HCL | Recombinant Human ADH7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH7 Products
Required fields are marked with *
My Review for All ADH7 Products
Required fields are marked with *
