"ADI1" Related Products

Expand
Expand
Expand

Recombinant Human ADI1 protein, T7-tagged

Cat.No.: ADI1-165H
Product Overview: Recombinant human ADI1 gene ( 179aa, Isoform-1 ) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNY SWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFT VDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: ADI1 acireductone dioxygenase 1 [ Homo sapiens ]
Official Symbol: ADI1
Synonyms: ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD;
Gene ID: 55256
mRNA Refseq: NM_018269
Protein Refseq: NP_060739
MIM: 613400
UniProt ID: Q9BV57
Chromosome Location: 2p25.2
Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem; Methionine salvage pathway, organism-specific biosystem;
Function: acireductone dioxygenase [iron(II)-requiring] activity; metal ion binding; oxidoreductase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.