Recombinant Human ADI1 protein, T7-tagged
| Cat.No. : | ADI1-165H |
| Product Overview : | Recombinant human ADI1 gene ( 179aa, Isoform-1 ) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 179 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNY SWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFT VDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | ADI1 acireductone dioxygenase 1 [ Homo sapiens ] |
| Official Symbol | ADI1 |
| Synonyms | ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD; |
| Gene ID | 55256 |
| mRNA Refseq | NM_018269 |
| Protein Refseq | NP_060739 |
| MIM | 613400 |
| UniProt ID | Q9BV57 |
| Chromosome Location | 2p25.2 |
| Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem; Methionine salvage pathway, organism-specific biosystem; |
| Function | acireductone dioxygenase [iron(II)-requiring] activity; metal ion binding; oxidoreductase activity; protein binding; |
| ◆ Recombinant Proteins | ||
| ADI1-946HF | Recombinant Full Length Human ADI1 Protein, GST-tagged | +Inquiry |
| Adi1-271M | Recombinant Mouse Adi1 Protein, MYC/DDK-tagged | +Inquiry |
| ADI1-165H | Recombinant Human ADI1 protein, T7-tagged | +Inquiry |
| ADI1-347M | Recombinant Mouse ADI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADI1-27097TH | Recombinant Human ADI1, T7 -tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADI1-9011HCL | Recombinant Human ADI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADI1 Products
Required fields are marked with *
My Review for All ADI1 Products
Required fields are marked with *



