Recombinant Human ADI1 protein, T7-tagged
Cat.No. : | ADI1-165H |
Product Overview : | Recombinant human ADI1 gene ( 179aa, Isoform-1 ) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 179 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNY SWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFT VDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ADI1 acireductone dioxygenase 1 [ Homo sapiens ] |
Official Symbol | ADI1 |
Synonyms | ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD; |
Gene ID | 55256 |
mRNA Refseq | NM_018269 |
Protein Refseq | NP_060739 |
MIM | 613400 |
UniProt ID | Q9BV57 |
Chromosome Location | 2p25.2 |
Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem; Methionine salvage pathway, organism-specific biosystem; |
Function | acireductone dioxygenase [iron(II)-requiring] activity; metal ion binding; oxidoreductase activity; protein binding; |
◆ Recombinant Proteins | ||
ADI1-2764C | Recombinant Chicken ADI1 | +Inquiry |
ADI1-5003H | Recombinant Human ADI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADI1-347M | Recombinant Mouse ADI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADI1-27097TH | Recombinant Human ADI1, T7 -tagged | +Inquiry |
ADI1-392H | Recombinant Human Acireductone Dioxygenase 1, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADI1-9011HCL | Recombinant Human ADI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADI1 Products
Required fields are marked with *
My Review for All ADI1 Products
Required fields are marked with *
0
Inquiry Basket