Recombinant Human ADIG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ADIG-4791H |
Product Overview : | ADIG MS Standard C13 and N15-labeled recombinant protein (NP_001018092) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation. |
Molecular Mass : | 9.5 kDa |
AA Sequence : | MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ADIG adipogenin [ Homo sapiens (human) ] |
Official Symbol | ADIG |
Synonyms | adipogenin; SMAF1; adipogenesis associated; MGC39724; RP5-1100H13.2; small adipocyte factor 1 (SMAF1) |
Gene ID | 149685 |
mRNA Refseq | NM_001018082 |
Protein Refseq | NP_001018092 |
MIM | 611396 |
UniProt ID | Q0VDE8 |
◆ Recombinant Proteins | ||
RFL-13028HF | Recombinant Full Length Human Adipogenin(Adig) Protein, His-Tagged | +Inquiry |
Adig-1540M | Recombinant Mouse Adig Protein, Myc/DDK-tagged | +Inquiry |
ADIG-4791H | Recombinant Human ADIG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL-153SF | Recombinant Full Length Pig Adipogenin(Adig) Protein, His-Tagged | +Inquiry |
ADIG-9424H | Recombinant Human ADIG, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIG-9010HCL | Recombinant Human ADIG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIG Products
Required fields are marked with *
My Review for All ADIG Products
Required fields are marked with *
0
Inquiry Basket