Active Recombinant Human ADIPOQ protein
| Cat.No. : | ADIPOQ-255H |
| Product Overview : | Recombinant Human ADIPOQ, transcript variant 2, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
| Bio-activity : | Determined by a cytotoxicity assay using M1 cells. The expected ED50 for this effect is 0.5-1.0 ug/ml. |
| Molecular Mass : | 18.1 kDa |
| AA Sequence : | PGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Resuspend the protein in the desired concentration in proper buffer |
| Gene Name | ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ] |
| Official Symbol | ADIPOQ |
| Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1; |
| Gene ID | 9370 |
| mRNA Refseq | NM_004797 |
| Protein Refseq | NP_004788 |
| MIM | 605441 |
| UniProt ID | Q15848 |
| ◆ Recombinant Proteins | ||
| ADIPOQ-7114C | Recombinant Chicken ADIPOQ | +Inquiry |
| ADIPOQ-1416C | Recombinant Cynomolgus ADIPOQ protein, His-tagged | +Inquiry |
| ADIPOQ-254H | Active Recombinant Human ADIPOQ protein, His-tagged | +Inquiry |
| ADIPOQ-188D | Recombinant Dog ADIPOQ, FLAG-tagged | +Inquiry |
| ADIPOQ-133H | Recombinant Human ADIPOQ protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
| ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *



