Recombinant Human ADIPOR1 protein, His/SUMO-tagged
| Cat.No. : | ADIPOR1-626H |
| Product Overview : | Recombinant Human DNASE1L3(1-375 aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-375 aa |
| Description : | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. |
| Form : | Tris-based buffer, 50% glycerol |
| AA Sequence : | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE FRYGLEGGCTDDTLL |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
| Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens ] |
| Official Symbol | ADIPOR1 |
| Synonyms | ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464; |
| Gene ID | 51094 |
| mRNA Refseq | NM_015999 |
| Protein Refseq | NP_057083 |
| MIM | 607945 |
| UniProt ID | Q96A54 |
| Chromosome Location | 1q32.1 |
| Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; |
| Function | hormone binding; identical protein binding; protein heterodimerization activity; protein kinase binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| ADIPOR1-76R | Recombinant Rhesus Macaque ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADIPOR1-285H | Recombinant Human ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADIPOR1-2351H | Recombinant Human ADIPOR1 protein, His-Flag-tagged | +Inquiry |
| ADIPOR1-9426H | Recombinant Human ADIPOR1, GST-tagged | +Inquiry |
| Adipor1-1541M | Recombinant Mouse Adipor1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOR1-026HKCL | Human ADIPOR1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *
