Recombinant Human ADIPOR1 Transmembrane protein, His-Flag-tagged
| Cat.No. : | ADIPOR1-1354H |
| Product Overview : | Recombinant Human ADIPOR1 protein(Q96A54)(89-375aa), fused with N-terminal His-Flag tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Flag&His |
| Protein Length : | 89-375aa |
| Form : | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Molecular Mass : | 34.8 kDa |
| AA Sequence : | EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens ] |
| Official Symbol | ADIPOR1 |
| Synonyms | ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464; |
| Gene ID | 51094 |
| mRNA Refseq | NM_015999 |
| Protein Refseq | NP_057083 |
| MIM | 607945 |
| UniProt ID | Q96A54 |
| ◆ Recombinant Proteins | ||
| ADIPOR1-609H | Recombinant Human ADIPOR1 protein, His & GST-tagged | +Inquiry |
| ADIPOR1-1354H | Recombinant Human ADIPOR1 Transmembrane protein, His-Flag-tagged | +Inquiry |
| ADIPOR1-3199H | Recombinant Human ADIPOR1, His-tagged, MBP tagged | +Inquiry |
| ADIPOR1-285H | Recombinant Human ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADIPOR1-76R | Recombinant Rhesus Macaque ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOR1-026HKCL | Human ADIPOR1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *
