Recombinant Human ADIRF Protein, His&SUMO-tagged
| Cat.No. : | ADIRF-17H |
| Product Overview : | Recombinant Human ADIRF Protein, His&SUMO-tagged |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-76 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 20 kDa |
| AASequence : | MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| ◆ Recombinant Proteins | ||
| ADIRF-5670C | Recombinant Chicken ADIRF | +Inquiry |
| ADIRF-3309H | Recombinant Human ADIRF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ADIRF-17H | Recombinant Human ADIRF Protein, His&SUMO-tagged | +Inquiry |
| ADIRF-1632HF | Recombinant Full Length Human ADIRF Protein, GST-tagged | +Inquiry |
| ADIRF-1371H | Recombinant Human ADIRF Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIRF Products
Required fields are marked with *
My Review for All ADIRF Products
Required fields are marked with *



