Recombinant Human ADIRF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ADIRF-3309H |
Product Overview : | C10orf116 MS Standard C13 and N15-labeled recombinant protein (NP_006820) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ADIRF adipogenesis regulatory factor [ Homo sapiens (human) ] |
Official Symbol | ADIRF |
Synonyms | ADIRF; adipogenesis regulatory factor; AFRO; APM2; apM-2; C10orf116; adipogenesis regulatory factor; adipogenesis factor rich in obesity; adipose most abundant gene transcript 2 protein; adipose specific 2; adipose-specific protein 2 |
Gene ID | 10974 |
mRNA Refseq | NM_006829 |
Protein Refseq | NP_006820 |
UniProt ID | Q15847 |
◆ Recombinant Proteins | ||
ADIRF-1632HF | Recombinant Full Length Human ADIRF Protein, GST-tagged | +Inquiry |
ADIRF-1371H | Recombinant Human ADIRF Protein, MYC/DDK-tagged | +Inquiry |
ADIRF-3309H | Recombinant Human ADIRF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADIRF-5670C | Recombinant Chicken ADIRF | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIRF Products
Required fields are marked with *
My Review for All ADIRF Products
Required fields are marked with *