Recombinant Human ADIRF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ADIRF-3309H
• Product Overview: C10orf116 MS Standard C13 and N15-labeled recombinant protein (NP_006820) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown.
• Molecular Mass: 7.9 kDa
• AA Sequence: MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ADIRF adipogenesis regulatory factor [ Homo sapiens (human) ]
• Official Symbol: ADIRF
• Synonyms: ADIRF; adipogenesis regulatory factor; AFRO; APM2; apM-2; C10orf116; adipogenesis regulatory factor; adipogenesis factor rich in obesity; adipose most abundant gene transcript 2 protein; adipose specific 2; adipose-specific protein 2
• Gene ID: 10974
• mRNA Refseq: NM_006829
• Protein Refseq: NP_006820
• UniProt ID: Q15847