Recombinant Human ADM
| Cat.No. : | ADM-27104TH |
| Product Overview : | Recombinant fragment of Human Adrenomedullin with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKA GPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNN FQGLRSFGCRFGTCTVQKLAHQIYQFTDKD |
| Sequence Similarities : | Belongs to the adrenomedullin family. |
| Gene Name | ADM adrenomedullin [ Homo sapiens ] |
| Official Symbol | ADM |
| Synonyms | ADM; adrenomedullin; AM; |
| Gene ID | 133 |
| mRNA Refseq | NM_001124 |
| Protein Refseq | NP_001115 |
| MIM | 103275 |
| Uniprot ID | P35318 |
| Chromosome Location | 11 |
| Pathway | Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
| Function | adrenomedullin receptor binding; hormone activity; receptor binding; |
| ◆ Recombinant Proteins | ||
| ADM-1113C | Recombinant Chimpanzee ADM protein, His&Myc-tagged | +Inquiry |
| ADM-530R | Recombinant Rat ADM Protein | +Inquiry |
| ADM-948HF | Recombinant Full Length Human ADM Protein, GST-tagged | +Inquiry |
| ADM-856H | Recombinant Human ADM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ADM-3226C | Recombinant Cattle ADM, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADM-1530HCL | Recombinant Human ADM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADM Products
Required fields are marked with *
My Review for All ADM Products
Required fields are marked with *
