Recombinant Human ADM

Cat.No. : ADM-27104TH
Product Overview : Recombinant fragment of Human Adrenomedullin with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Adrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide. It may function as a hormone in circulation control because it is found in blood in a considerable concentration. The precursor, called preproadrenomedullin, is 185 amino acids long. By RNA-blot analysis, human adrenomedullin mRNA was found to be highly expressed in several tissues. Genomic ADM DNA consists of 4 exons and 3 introns, with the 5-prime flanking region containing TATA, CAAT, and GC boxes. There are also multiple binding sites for activator protein-2 and a cAMP-regulated enhancer element.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKA GPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNN FQGLRSFGCRFGTCTVQKLAHQIYQFTDKD
Sequence Similarities : Belongs to the adrenomedullin family.
Gene Name ADM adrenomedullin [ Homo sapiens ]
Official Symbol ADM
Synonyms ADM; adrenomedullin; AM;
Gene ID 133
mRNA Refseq NM_001124
Protein Refseq NP_001115
MIM 103275
Uniprot ID P35318
Chromosome Location 11
Pathway Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function adrenomedullin receptor binding; hormone activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADM Products

Required fields are marked with *

My Review for All ADM Products

Required fields are marked with *

0
cart-icon
0
compare icon