Recombinant Human ADM Protein, His-tagged

Cat.No. : ADM-233H
Product Overview : Recombinant Human ADM protein(Ala22~Gly147), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ala22~Gly147
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 0.1% SKL.
Molecular Mass : The protein has a calculated MW of 16 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.94 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGHHHHHHSGSEFARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYG
Gene Name ADM adrenomedullin [ Homo sapiens ]
Official Symbol ADM
Synonyms ADM; adrenomedullin; AM; preproadrenomedullin;
Gene ID 133
mRNA Refseq NM_001124
Protein Refseq NP_001115
MIM 103275
UniProt ID P35318

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADM Products

Required fields are marked with *

My Review for All ADM Products

Required fields are marked with *

0
cart-icon