Recombinant Human ADM Protein, His-tagged
Cat.No. : | ADM-233H |
Product Overview : | Recombinant Human ADM protein(Ala22~Gly147), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala22~Gly147 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4, 0.1% SKL. |
Molecular Mass : | The protein has a calculated MW of 16 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.94 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGHHHHHHSGSEFARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYG |
Gene Name | ADM adrenomedullin [ Homo sapiens ] |
Official Symbol | ADM |
Synonyms | ADM; adrenomedullin; AM; preproadrenomedullin; |
Gene ID | 133 |
mRNA Refseq | NM_001124 |
Protein Refseq | NP_001115 |
MIM | 103275 |
UniProt ID | P35318 |
◆ Recombinant Proteins | ||
ADM-1361H | Recombinant Human ADM Protein, MYC/DDK-tagged | +Inquiry |
ADM-856H | Recombinant Human ADM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADM-351M | Recombinant Mouse ADM Protein, His (Fc)-Avi-tagged | +Inquiry |
ADM-1113C | Recombinant Chimpanzee ADM protein, His&Myc-tagged | +Inquiry |
ADM-1365M | Recombinant Mouse ADM Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADM-1530HCL | Recombinant Human ADM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADM Products
Required fields are marked with *
My Review for All ADM Products
Required fields are marked with *