Recombinant Human ADM Protein, His-tagged

• Cat.No.: ADM-233H
• Product Overview: Recombinant Human ADM protein(Ala22~Gly147), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ala22~Gly147
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 0.1% SKL.
• Molecular Mass: The protein has a calculated MW of 16 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.94 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGHHHHHHSGSEFARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYG

Gene Information

• Gene Name: ADM adrenomedullin [ Homo sapiens ]
• Official Symbol: ADM
• Synonyms: ADM; adrenomedullin; AM; preproadrenomedullin
• Gene ID: 133
• mRNA Refseq: NM_001124
• Protein Refseq: NP_001115
• MIM: 103275
• UniProt ID: P35318