Recombinant Human ADNP Protein, GST-tagged

Cat.No. : ADNP-365H
Product Overview : Human ADNP partial ORF ( NP_056154, 1018 a.a. - 1102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.09 kDa
AA Sequence : TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADNP activity-dependent neuroprotector homeobox [ Homo sapiens ]
Official Symbol ADNP
Synonyms ADNP; activity-dependent neuroprotector homeobox; activity dependent neuroprotector; activity-dependent neuroprotector homeobox protein; ADNP homeobox 1; ADNP1; KIAA0784; activity-dependent neuroprotective protein;
Gene ID 23394
mRNA Refseq NM_015339
Protein Refseq NP_056154
MIM 611386
UniProt ID Q9H2P0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADNP Products

Required fields are marked with *

My Review for All ADNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon