Recombinant Human ADNP Protein, GST-tagged
Cat.No. : | ADNP-365H |
Product Overview : | Human ADNP partial ORF ( NP_056154, 1018 a.a. - 1102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.09 kDa |
AA Sequence : | TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADNP activity-dependent neuroprotector homeobox [ Homo sapiens ] |
Official Symbol | ADNP |
Synonyms | ADNP; activity-dependent neuroprotector homeobox; activity dependent neuroprotector; activity-dependent neuroprotector homeobox protein; ADNP homeobox 1; ADNP1; KIAA0784; activity-dependent neuroprotective protein; |
Gene ID | 23394 |
mRNA Refseq | NM_015339 |
Protein Refseq | NP_056154 |
MIM | 611386 |
UniProt ID | Q9H2P0 |
◆ Recombinant Proteins | ||
ADNP-80R | Recombinant Rhesus Macaque ADNP Protein, His (Fc)-Avi-tagged | +Inquiry |
ADNP-252R | Recombinant Rhesus monkey ADNP Protein, His-tagged | +Inquiry |
ADNP-1701H | Recombinant Human ADNP protein, His & GST-tagged | +Inquiry |
ADNP-365H | Recombinant Human ADNP Protein, GST-tagged | +Inquiry |
ADNP-0118H | Recombinant Human ADNP Protein (Ala528-Thr782), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADNP-9008HCL | Recombinant Human ADNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADNP Products
Required fields are marked with *
My Review for All ADNP Products
Required fields are marked with *