Recombinant Human ADORA2A protein, GST-tagged
Cat.No. : | ADORA2A-318H |
Product Overview : | Recombinant Human ADORA2A protein(NP_000666)(300-412 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 300-412 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ADORA2A adenosine A2a receptor [ Homo sapiens ] |
Official Symbol | ADORA2A |
Synonyms | ADORA2A; adenosine A2a receptor; ADORA2; adenosine receptor A2a; RDC8; adenosine A2 receptor; adenosine receptor subtype A2a; hA2aR; |
Gene ID | 135 |
mRNA Refseq | NM_000675 |
Protein Refseq | NP_000666 |
MIM | 102776 |
UniProt ID | P29274 |
◆ Cell & Tissue Lysates | ||
ADORA2A-33HCL | Recombinant Human ADORA2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA2A Products
Required fields are marked with *
My Review for All ADORA2A Products
Required fields are marked with *
0
Inquiry Basket