Recombinant Human ADORA3

Cat.No. : ADORA3-26898TH
Product Overview : Recombinant fragment corresponding to amino acids 121-225 of Human Adenosine A3 Receptor with N terminal proprietary tag; predicted MW: 37.18 kDa, inclusive of tag. P33765, AAH29831.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 105 amino acids
Description : This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.180kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRN VTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDI FYIIRNKLSLNLSNSKETGAFYGRE
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name ADORA3 adenosine A3 receptor [ Homo sapiens ]
Official Symbol ADORA3
Synonyms ADORA3; adenosine A3 receptor; adenosine receptor A3; AD026;
Gene ID 140
mRNA Refseq NM_000677
Protein Refseq NP_000668
MIM 600445
Uniprot ID P33765
Chromosome Location 1p21-p13
Pathway Adenosine P1 receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function G-protein coupled adenosine receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADORA3 Products

Required fields are marked with *

My Review for All ADORA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon