Recombinant Human ADPGK Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ADPGK-3770H |
Product Overview : | ADPGK MS Standard C13 and N15-labeled recombinant protein (NP_112574) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. |
Molecular Mass : | 54.1 kDa |
AA Sequence : | MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ADPGK ADP-dependent glucokinase [ Homo sapiens (human) ] |
Official Symbol | ADPGK |
Synonyms | ADPGK; ADP-dependent glucokinase; ADP GK; DKFZp434B195; rbBP-35; ATP-dependent glucokinase; ADP-GK; 2610017G09Rik; |
Gene ID | 83440 |
mRNA Refseq | NM_031284 |
Protein Refseq | NP_112574 |
MIM | 611861 |
UniProt ID | Q9BRR6 |
◆ Recombinant Proteins | ||
ADPGK-358M | Recombinant Mouse ADPGK Protein, His (Fc)-Avi-tagged | +Inquiry |
ADPGK-985H | Recombinant Human ADPGK protein, MYC/DDK-tagged | +Inquiry |
ADPGK-3770H | Recombinant Human ADPGK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADPGK-5433H | Recombinant Human ADPGK protein, His-tagged | +Inquiry |
ADPGK-719HF | Recombinant Full Length Human ADPGK Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPGK-9004HCL | Recombinant Human ADPGK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADPGK Products
Required fields are marked with *
My Review for All ADPGK Products
Required fields are marked with *