Recombinant Human ADPGK protein, GST-tagged
Cat.No. : | ADPGK-33H |
Product Overview : | Recombinant Human ADPGK(1 a.a. - 497 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-497 a.a. |
Description : | ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 80.5 kDa |
AA Sequence : | MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ADPGK ADP-dependent glucokinase [ Homo sapiens ] |
Official Symbol | ADPGK |
Synonyms | ADPGK; ADP-dependent glucokinase; ADP GK; DKFZp434B195; rbBP-35; ATP-dependent glucokinase; ADP-GK; 2610017G09Rik; |
Gene ID | 83440 |
mRNA Refseq | NM_031284 |
Protein Refseq | NP_112574 |
MIM | 611861 |
UniProt ID | Q9BRR6 |
Chromosome Location | 15q24.1 |
Pathway | Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ADP-specific glucokinase activity; metal ion binding; transferase activity; |
◆ Recombinant Proteins | ||
ADPGK-1374M | Recombinant Mouse ADPGK Protein | +Inquiry |
ADPGK-34H | Recombinant Human ADPGK protein, GST-tagged | +Inquiry |
ADPGK-5548C | Recombinant Chicken ADPGK | +Inquiry |
ADPGK-33H | Recombinant Human ADPGK protein, GST-tagged | +Inquiry |
ABCC2-3433H | Recombinant Human ABCC2 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPGK-9004HCL | Recombinant Human ADPGK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADPGK Products
Required fields are marked with *
My Review for All ADPGK Products
Required fields are marked with *
0
Inquiry Basket