Recombinant Human ADPGK protein, GST-tagged
| Cat.No. : | ADPGK-33H | 
| Product Overview : | Recombinant Human ADPGK(1 a.a. - 497 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Protein Length : | 1-497 a.a. | 
| Description : | ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]). | 
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 80.5 kDa | 
| AA Sequence : | MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Gene Name | ADPGK ADP-dependent glucokinase [ Homo sapiens ] | 
| Official Symbol | ADPGK | 
| Synonyms | ADPGK; ADP-dependent glucokinase; ADP GK; DKFZp434B195; rbBP-35; ATP-dependent glucokinase; ADP-GK; 2610017G09Rik; | 
| Gene ID | 83440 | 
| mRNA Refseq | NM_031284 | 
| Protein Refseq | NP_112574 | 
| MIM | 611861 | 
| UniProt ID | Q9BRR6 | 
| Chromosome Location | 15q24.1 | 
| Pathway | Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; | 
| Function | ADP-specific glucokinase activity; metal ion binding; transferase activity; | 
| ◆ Recombinant Proteins | ||
| Adpgk-1543M | Recombinant Mouse Adpgk Protein, Myc/DDK-tagged | +Inquiry | 
| ADPGK-358M | Recombinant Mouse ADPGK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ADPGK-5434H | Recombinant Human ADPGK protein, His-tagged | +Inquiry | 
| ADPGK-4923Z | Recombinant Zebrafish ADPGK | +Inquiry | 
| ADPGK-5433H | Recombinant Human ADPGK protein, His-tagged | +Inquiry | 
| ◆ Native Proteins | ||
| ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ADPGK-9004HCL | Recombinant Human ADPGK 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ADPGK Products
Required fields are marked with *
My Review for All ADPGK Products
Required fields are marked with *
  
        
    
      
            