Recombinant Human ADPGK protein, GST-tagged

• Cat.No.: ADPGK-34H
• Product Overview: Recombinant Human ADPGK(148-497aa) fused with GST tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 148-497 a.a.
• Description: ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).
• Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
• AA Sequence: EFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.

Gene Information

• Gene Name: ADPGK ADP-dependent glucokinase [ Homo sapiens ]
• Official Symbol: ADPGK
• Synonyms: ADPGK; ADP-dependent glucokinase; ADP GK; DKFZp434B195; rbBP-35; ATP-dependent glucokinase; ADP-GK; 2610017G09Rik
• Gene ID: 83440
• mRNA Refseq: NM_031284
• Protein Refseq: NP_112574
• MIM: 611861
• UniProt ID: Q9BRR6
• Chromosome Location: 15q24.1
• Pathway: Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: ADP-specific glucokinase activity; metal ion binding; transferase activity