Recombinant Human ADPRH Protein, GST-tagged
| Cat.No. : | ADPRH-374H |
| Product Overview : | Human ADPRH full-length ORF ( NP_001116.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, May 2014] |
| Molecular Mass : | 65.9 kDa |
| AA Sequence : | MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens ] |
| Official Symbol | ADPRH |
| Synonyms | ADPRH; ADP-ribosylarginine hydrolase; [Protein ADP-ribosylarginine] hydrolase; ARH1; ADP-ribose-L-arginine cleaving enzyme; |
| Gene ID | 141 |
| mRNA Refseq | NM_001125 |
| Protein Refseq | NP_001116 |
| MIM | 603081 |
| UniProt ID | P54922 |
| ◆ Recombinant Proteins | ||
| ADPRH-2063H | Recombinant Human ADP-ribosylarginine Hydrolase, His-tagged | +Inquiry |
| Adprh-547M | Recombinant Mouse Adprh Protein, MYC/DDK-tagged | +Inquiry |
| ADPRH-973HF | Recombinant Full Length Human ADPRH Protein, GST-tagged | +Inquiry |
| ADPRH-900Z | Recombinant Zebrafish ADPRH | +Inquiry |
| ADPRH-359M | Recombinant Mouse ADPRH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADPRH-9003HCL | Recombinant Human ADPRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADPRH Products
Required fields are marked with *
My Review for All ADPRH Products
Required fields are marked with *
