Recombinant Human ADPRH protein, His-tagged
Cat.No. : | ADPRH-2156H |
Product Overview : | Recombinant Human ADPRH protein(1-357 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-357 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL |
Gene Name | ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens ] |
Official Symbol | ADPRH |
Synonyms | ADPRH; ADP-ribosylarginine hydrolase; [Protein ADP-ribosylarginine] hydrolase; ARH1; ADP-ribose-L-arginine cleaving enzyme; |
Gene ID | 141 |
mRNA Refseq | NM_001125 |
Protein Refseq | NP_001116 |
MIM | 603081 |
UniProt ID | P54922 |
◆ Recombinant Proteins | ||
ADPRH-2156H | Recombinant Human ADPRH protein, His-tagged | +Inquiry |
ACSF3-1224M | Recombinant Mouse ACSF3 Protein | +Inquiry |
ACSF3-7353H | Recombinant Human ACSF3 protein, His-tagged | +Inquiry |
ACSF3-271M | Recombinant Mouse ACSF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSF3-788HF | Recombinant Full Length Human ACSF3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSF3-1001HCL | Recombinant Human ACSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSF3 Products
Required fields are marked with *
My Review for All ACSF3 Products
Required fields are marked with *