Recombinant Human ADRA1A protein(351-420 aa), C-His-tagged

Cat.No. : ADRA1A-2736H
Product Overview : Recombinant Human ADRA1A protein(P35348)(351-420 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 351-420 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
Gene Name ADRA1A adrenergic, alpha-1A-, receptor [ Homo sapiens ]
Official Symbol ADRA1A
Synonyms ADRA1A; adrenergic, alpha-1A-, receptor; ADRA1C; alpha-1A adrenergic receptor; ADRA1L1; alpha-1A adrenoceptor; alpha-1A adrenoreceptor; G protein coupled receptor; alpha-1C adrenergic receptor; adrenergic, alpha-1A-, receptor variant 1; adrenergic, alpha-1A-, receptor variant 3; adrenergic, alpha-1A-, receptor variant 5; adrenergic, alpha-1A-, receptor variant 8; ALPHA1AAR;
Gene ID 148
mRNA Refseq NM_000680
Protein Refseq NP_000671
MIM 104221
UniProt ID P35348

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADRA1A Products

Required fields are marked with *

My Review for All ADRA1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon