Recombinant Human ADRB1 Protein (378-477 aa), His-tagged

Cat.No. : ADRB1-1319H
Product Overview : Recombinant Human ADRB1 Protein (378-477 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 378-477 aa
Description : Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 12.5 kDa
AA Sequence : CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ADRB1 adrenergic, beta-1-, receptor [ Homo sapiens ]
Official Symbol ADRB1
Synonyms ADRB1; ADRB1R; RHR; B1AR; BETA1AR;
Gene ID 153
mRNA Refseq NM_000684
Protein Refseq NP_000675
UniProt ID P08588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADRB1 Products

Required fields are marked with *

My Review for All ADRB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon