Recombinant Human ADRB1 Protein, His-tagged
Cat.No. : | ADRB1-01H |
Product Overview : | Recombinant Human partial (378-477aa) Beta-1 adrenergic receptor protein with His tag was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 378-477 a.a. |
Description : | Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. |
Molecular Mass : | 12.5kDa |
AA Sequence : | CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. |
Storage : | Store working aliquots at 4 centigrade for up to one week. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Storage Buffer : | Tris-based buffer, 50% glycerol |
Gene Name | ADRB1 adrenoceptor beta 1 [ Homo sapiens (human) ] |
Official Symbol | ADRB1 |
Synonyms | ADRB1; adrenoceptor beta 1; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; RHR; B1AR; ADRB1R; BETA1AR; beta-1 adrenergic receptor; adrenergic, beta-1-, receptor; beta-1 adrenoceptor; beta-1 adrenoreceptor |
Gene ID | 153 |
mRNA Refseq | NM_000684 |
Protein Refseq | NP_000675 |
MIM | 109630 |
UniProt ID | P08588 |
◆ Recombinant Proteins | ||
ADRB1-1017H | Active Recombinant Human Adrenergic, Beta-1-, Receptor, Flag-His | +Inquiry |
ADRB1-544R | Recombinant Rat ADRB1 Protein | +Inquiry |
ADRB1-6980Z | Recombinant Zebrafish ADRB1 | +Inquiry |
ADRB1-5988H | Recombinant Human ADRB1 Full Length Transmembrane protein, His-tagged(VLPs) | +Inquiry |
ADRB1-01H | Recombinant Human ADRB1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADRB1 Products
Required fields are marked with *
My Review for All ADRB1 Products
Required fields are marked with *