"ADRB1" Related Products

Expand

Recombinant Human ADRB1 Protein, His-tagged

Cat.No.: ADRB1-01H
Product Overview: Recombinant Human partial (378-477aa) Beta-1 adrenergic receptor protein with His tag was expressed in Yeast.
Description: Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
Source: Yeast
Species: Human
Tag : His
Molecular Mass: 12.5kDa
AA Sequence: CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended.
Storage: Store working aliquots at 4 centigrade for up to one week. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Storage Buffer: Tris-based buffer, 50% glycerol
Gene Name: ADRB1 adrenoceptor beta 1 [ Homo sapiens (human) ]
Official Symbol: ADRB1
Synonyms: ADRB1; adrenoceptor beta 1; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; RHR; B1AR; ADRB1R; BETA1AR; beta-1 adrenergic receptor; adrenergic, beta-1-, receptor; beta-1 adrenoceptor; beta-1 adrenoreceptor
Gene ID: 153
mRNA Refseq: NM_000684
Protein Refseq: NP_000675
MIM: 109630
UniProt ID: P08588

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.