Recombinant Human ADRB1 Protein, His-tagged

Cat.No. : ADRB1-01H
Product Overview : Recombinant Human partial (378-477aa) Beta-1 adrenergic receptor protein with His tag was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 378-477 a.a.
Description : Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
Molecular Mass : 12.5kDa
AA Sequence : CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended.
Storage : Store working aliquots at 4 centigrade for up to one week. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Storage Buffer : Tris-based buffer, 50% glycerol
Gene Name ADRB1 adrenoceptor beta 1 [ Homo sapiens (human) ]
Official Symbol ADRB1
Synonyms ADRB1; adrenoceptor beta 1; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; RHR; B1AR; ADRB1R; BETA1AR; beta-1 adrenergic receptor; adrenergic, beta-1-, receptor; beta-1 adrenoceptor; beta-1 adrenoreceptor
Gene ID 153
mRNA Refseq NM_000684
Protein Refseq NP_000675
MIM 109630
UniProt ID P08588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADRB1 Products

Required fields are marked with *

My Review for All ADRB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon