Recombinant Human ADRBK1 protein, His-tagged
| Cat.No. : | ADRBK1-9445H |
| Product Overview : | Recombinant Human ADRBK1 protein(390-689 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | September 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 390-689 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL |
| Gene Name | ADRBK1 adrenergic, beta, receptor kinase 1 [ Homo sapiens ] |
| Official Symbol | ADRBK1 |
| Synonyms | ADRBK1; adrenergic, beta, receptor kinase 1; beta-adrenergic receptor kinase 1; BARK1; GRK2; beta-ARK-1; G-protein coupled receptor kinase 2; BETA-ARK1; FLJ16718; |
| Gene ID | 156 |
| mRNA Refseq | NM_001619 |
| Protein Refseq | NP_001610 |
| MIM | 109635 |
| UniProt ID | P25098 |
| ◆ Recombinant Proteins | ||
| ADRBK1-978H | Recombinant Human ADRBK1 protein(Met1-Leu689), His&GST-tagged | +Inquiry |
| ADRBK1-1562HF | Active Recombinant Full Length Human ADRBK1 Protein, GST-tagged | +Inquiry |
| ADRBK1-202R | Recombinant Rat ADRBK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADRBK1-2437H | Recombinant Human ADRBK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADRBK1-1019H | Recombinant Human Adrenergic, Beta, Receptor Kinase 1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADRBK1-625HCL | Recombinant Human ADRBK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADRBK1 Products
Required fields are marked with *
My Review for All ADRBK1 Products
Required fields are marked with *
