Recombinant Human ADRBK1 protein, His-tagged
Cat.No. : | ADRBK1-9445H |
Product Overview : | Recombinant Human ADRBK1 protein(390-689 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 390-689 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL |
Gene Name | ADRBK1 adrenergic, beta, receptor kinase 1 [ Homo sapiens ] |
Official Symbol | ADRBK1 |
Synonyms | ADRBK1; adrenergic, beta, receptor kinase 1; beta-adrenergic receptor kinase 1; BARK1; GRK2; beta-ARK-1; G-protein coupled receptor kinase 2; BETA-ARK1; FLJ16718; |
Gene ID | 156 |
mRNA Refseq | NM_001619 |
Protein Refseq | NP_001610 |
MIM | 109635 |
UniProt ID | P25098 |
◆ Recombinant Proteins | ||
ADRBK1-357H | Recombinant Human Adrenergic, Beta, Receptor Kinase 1, His-tagged | +Inquiry |
ADRBK1-1562HF | Active Recombinant Full Length Human ADRBK1 Protein, GST-tagged | +Inquiry |
ADRBK1-1019H | Recombinant Human Adrenergic, Beta, Receptor Kinase 1, GST-tagged | +Inquiry |
ADRBK1-546R | Recombinant Rat ADRBK1 Protein | +Inquiry |
ADRBK1-9445H | Recombinant Human ADRBK1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRBK1-625HCL | Recombinant Human ADRBK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADRBK1 Products
Required fields are marked with *
My Review for All ADRBK1 Products
Required fields are marked with *