Recombinant Human ADSSL1 Protein, GST-tagged
Cat.No. : | ADSSL1-393H |
Product Overview : | Human ADSSL1 partial ORF ( NP_689541.1, 369 a.a. - 436 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent onset distal myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 33.22 kDa |
AA Sequence : | VLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADSSL1 adenylosuccinate synthase like 1 [ Homo sapiens ] |
Official Symbol | ADSSL1 |
Synonyms | ADSSL1; adenylosuccinate synthase like 1; adenylosuccinate synthetase isozyme 1; FLJ38602; adSS 1; AMPSase 1; IMP--aspartate ligase 1; M-type adenylosuccinate synthetase; adenylosuccinate synthetase, basic isozyme; adenylosuccinate synthetase, muscle isozyme; |
Gene ID | 122622 |
mRNA Refseq | NM_152328 |
Protein Refseq | NP_689541 |
MIM | 612498 |
UniProt ID | Q8N142 |
◆ Recombinant Proteins | ||
ADSSL1-983HF | Recombinant Full Length Human ADSSL1 Protein, GST-tagged | +Inquiry |
Adssl1-3189M | Recombinant Mouse Adssl1, His-tagged | +Inquiry |
ADSSL1-12829Z | Recombinant Zebrafish ADSSL1 | +Inquiry |
Adssl1-550M | Recombinant Mouse Adssl1 Protein, MYC/DDK-tagged | +Inquiry |
ADSSL1-393H | Recombinant Human ADSSL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADSSL1-8993HCL | Recombinant Human ADSSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADSSL1 Products
Required fields are marked with *
My Review for All ADSSL1 Products
Required fields are marked with *
0
Inquiry Basket