Recombinant Human ADSSL1 Protein, GST-tagged

Cat.No. : ADSSL1-393H
Product Overview : Human ADSSL1 partial ORF ( NP_689541.1, 369 a.a. - 436 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent onset distal myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Molecular Mass : 33.22 kDa
AA Sequence : VLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADSSL1 adenylosuccinate synthase like 1 [ Homo sapiens ]
Official Symbol ADSSL1
Synonyms ADSSL1; adenylosuccinate synthase like 1; adenylosuccinate synthetase isozyme 1; FLJ38602; adSS 1; AMPSase 1; IMP--aspartate ligase 1; M-type adenylosuccinate synthetase; adenylosuccinate synthetase, basic isozyme; adenylosuccinate synthetase, muscle isozyme;
Gene ID 122622
mRNA Refseq NM_152328
Protein Refseq NP_689541
MIM 612498
UniProt ID Q8N142

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADSSL1 Products

Required fields are marked with *

My Review for All ADSSL1 Products

Required fields are marked with *

0
cart-icon