"AEBP1" Related Products

Expand
Expand

Recombinant Human AEBP2 Protein, GST-tagged

Cat.No. : AEBP1-394H
Product Overview : Human AEBP1 partial ORF ( NP_001120, 912 a.a. - 1013 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of carboxypeptidase A protein family. The encoded protein may function as a transcriptional repressor and play a role in adipogenesis and smooth muscle cell differentiation. Studies in mice suggest that this gene functions in wound healing and abdominal wall development. Overexpression of this gene is associated with glioblastoma. [provided by RefSeq, May 2013]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.96 kDa
AA Sequence : VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : AEBP1 AE binding protein 1 [ Homo sapiens ]
Official Symbol : AEBP1
Synonyms : AEBP1; AE binding protein 1; adipocyte enhancer-binding protein 1; ACLP; adipocyte enhancer binding protein 1; aortic carboxypeptidase like protein; AE-binding protein 1; aortic carboxypeptidase-like protein; FLJ33612;
Gene ID : 165
mRNA Refseq : NM_001129
Protein Refseq : NP_001120
MIM : 602981
UniProt ID : Q8IUX7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.