Recombinant Human AEBP2 Protein, GST-tagged
Cat.No. : | AEBP2-395H |
Product Overview : | Human AEBP2 full-length ORF ( NP_694939.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AEBP2 (AE Binding Protein 2) is a Protein Coding gene. Diseases associated with AEBP2 include Waardenburg Syndrome, Type 4A. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Chromatin organization. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding. |
Molecular Mass : | 59.4 kDa |
AA Sequence : | MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AEBP2 AE binding protein 2 [ Homo sapiens ] |
Official Symbol | AEBP2 |
Synonyms | AEBP2; AE binding protein 2; zinc finger protein AEBP2; MGC17922; AE-binding protein 2; adipocyte enhancer-binding protein 2; AE(adipocyte enhancer)-binding protein 2; |
Gene ID | 121536 |
mRNA Refseq | NM_001114176 |
Protein Refseq | NP_001107648 |
UniProt ID | Q6ZN18 |
◆ Recombinant Proteins | ||
AEBP2-395H | Recombinant Human AEBP2 Protein, GST-tagged | +Inquiry |
AEBP2-1394M | Recombinant Mouse AEBP2 Protein | +Inquiry |
AEBP2-1008HF | Recombinant Full Length Human AEBP2 Protein, GST-tagged | +Inquiry |
AEBP2-371M | Recombinant Mouse AEBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AEBP2-9452H | Recombinant Human AEBP2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AEBP2 Products
Required fields are marked with *
My Review for All AEBP2 Products
Required fields are marked with *