Recombinant Human AGAP1, His-tagged
| Cat.No. : | AGAP1-26447TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 675-804 a.a. |
| Description : | This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Tissue specificity : | Widely expressed. |
| Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII |
| Sequence Similarities : | Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain. |
| Gene Name | AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ] |
| Official Symbol | AGAP1 |
| Synonyms | AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099; |
| Gene ID | 116987 |
| mRNA Refseq | NM_014914 |
| Protein Refseq | NP_055729 |
| MIM | 608651 |
| Uniprot ID | Q9UPQ3 |
| Chromosome Location | 2q37 |
| Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
| Function | ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| AGAP1-2544H | Recombinant Human AGAP1 protein, His-tagged | +Inquiry |
| AGAP1-0007H | Recombinant Human AGAP1 Protein, GST-Tagged | +Inquiry |
| Agap1-1550M | Recombinant Mouse Agap1 Protein, Myc/DDK-tagged | +Inquiry |
| AGAP1-536H | Recombinant Human AGAP1 Protein, MYC/DDK-tagged | +Inquiry |
| AGAP1-94R | Recombinant Rhesus Macaque AGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGAP1-8984HCL | Recombinant Human AGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGAP1 Products
Required fields are marked with *
My Review for All AGAP1 Products
Required fields are marked with *
