Recombinant Human AGAP1, His-tagged
Cat.No. : | AGAP1-26447TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 675-804 a.a. |
Description : | This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII |
Sequence Similarities : | Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain. |
Gene Name | AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ] |
Official Symbol | AGAP1 |
Synonyms | AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099; |
Gene ID | 116987 |
mRNA Refseq | NM_014914 |
Protein Refseq | NP_055729 |
MIM | 608651 |
Uniprot ID | Q9UPQ3 |
Chromosome Location | 2q37 |
Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
Function | ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding; |
◆ Recombinant Proteins | ||
Agap1-1550M | Recombinant Mouse Agap1 Protein, Myc/DDK-tagged | +Inquiry |
AGAP1-94R | Recombinant Rhesus Macaque AGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGAP1-2579HF | Recombinant Full Length Human AGAP1 Protein, GST-tagged | +Inquiry |
AGAP1-2544H | Recombinant Human AGAP1 protein, His-tagged | +Inquiry |
AGAP1-536H | Recombinant Human AGAP1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGAP1-8984HCL | Recombinant Human AGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGAP1 Products
Required fields are marked with *
My Review for All AGAP1 Products
Required fields are marked with *
0
Inquiry Basket