Recombinant Human AGAP1, His-tagged

Cat.No. : AGAP1-26447TH
Product Overview : Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 675-804 a.a.
Description : This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII
Sequence Similarities : Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain.
Gene Name AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol AGAP1
Synonyms AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099;
Gene ID 116987
mRNA Refseq NM_014914
Protein Refseq NP_055729
MIM 608651
Uniprot ID Q9UPQ3
Chromosome Location 2q37
Pathway Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGAP1 Products

Required fields are marked with *

My Review for All AGAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon