Recombinant Human AGER protein, His-tagged
| Cat.No. : | AGER-3706H |
| Product Overview : | Recombinant Human AGER protein(26-340 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-340 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AGER advanced glycosylation end product-specific receptor [ Homo sapiens ] |
| Official Symbol | AGER |
| Synonyms | AGER; advanced glycosylation end product-specific receptor; RAGE; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta; |
| Gene ID | 177 |
| mRNA Refseq | NM_001136 |
| Protein Refseq | NP_001127 |
| MIM | 600214 |
| UniProt ID | Q15109 |
| ◆ Recombinant Proteins | ||
| AGER-1430C | Recombinant Cynomolgus AGER protein, His-tagged | +Inquiry |
| AGER-96R | Recombinant Rhesus Macaque AGER Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ager-2R | Recombinant Rat Ager Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGER-423H | Recombinant Human AGER Protein, GST-tagged | +Inquiry |
| AGER-0449H | Recombinant Human AGER Protein (Ala23-Ala344), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGER-2546HCL | Recombinant Human RAGE 293 Cell Lysate | +Inquiry |
| AGER-2215MCL | Recombinant Mouse AGER cell lysate | +Inquiry |
| AGER-1480HCL | Recombinant Human AGER cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGER Products
Required fields are marked with *
My Review for All AGER Products
Required fields are marked with *
