Recombinant Human AGFG2 Protein, GST-tagged

Cat.No. : AGFG2-5030H
Product Overview : Human HRBL full-length ORF ( ENSP00000262935, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. The 3 UTR of this gene contains an insulin receptor substrate 3-like pseudogene. [provided by RefSeq
Molecular Mass : 43.6 kDa
AA Sequence : MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWPDTFPRRLCQL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGFG2 ArfGAP with FG repeats 2 [ Homo sapiens ]
Official Symbol AGFG2
Synonyms AGFG2; ArfGAP with FG repeats 2; HIV 1 Rev binding protein like , HRBL; arf-GAP domain and FG repeat-containing protein 2; RABR; nucleoporin; HIV-1 Rev-binding protein-like protein; Rev/Rex activation domain binding protein-related; rev/Rex activation domain-binding protein related; arf-GAP domain and FG repeats-containing protein 2; HRBL;
Gene ID 3268
mRNA Refseq NM_006076
Protein Refseq NP_006067
MIM 604019
UniProt ID O95081

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGFG2 Products

Required fields are marked with *

My Review for All AGFG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon