Recombinant Human AGMAT Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AGMAT-5513H |
| Product Overview : | AGMAT MS Standard C13 and N15-labeled recombinant protein (NP_079034) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | AGMAT (Agmatinase) is a Protein Coding gene. Diseases associated with AGMAT include Dry Eye Syndrome and Renal Cell Carcinoma, Nonpapillary. Among its related pathways are Viral mRNA Translation and Regulation of activated PAK-2p34 by proteasome mediated degradation. Gene Ontology (GO) annotations related to this gene include agmatinase activity. An important paralog of this gene is ARG2. |
| Molecular Mass : | 37.8 kDa |
| AA Sequence : | MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | AGMAT agmatinase [ Homo sapiens (human) ] |
| Official Symbol | AGMAT |
| Synonyms | AGMAT; agmatine ureohydrolase (agmatinase); agmatinase, mitochondrial; FLJ23384; AUH; |
| Gene ID | 79814 |
| mRNA Refseq | NM_024758 |
| Protein Refseq | NP_079034 |
| MIM | 617887 |
| UniProt ID | Q9BSE5 |
| ◆ Recombinant Proteins | ||
| AGMAT-426H | Recombinant Human AGMAT Protein, GST-tagged | +Inquiry |
| AGMAT-0066H | Recombinant Human AGMAT Protein (Pro53-Ala151), N-GST-tagged | +Inquiry |
| AGMAT-5513H | Recombinant Human AGMAT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AGMAT-215R | Recombinant Rat AGMAT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Agmat-3240M | Recombinant Mouse Agmat, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGMAT-8978HCL | Recombinant Human AGMAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGMAT Products
Required fields are marked with *
My Review for All AGMAT Products
Required fields are marked with *
