Recombinant Human AGMAT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AGMAT-5513H
• Product Overview: AGMAT MS Standard C13 and N15-labeled recombinant protein (NP_079034) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: AGMAT (Agmatinase) is a Protein Coding gene. Diseases associated with AGMAT include Dry Eye Syndrome and Renal Cell Carcinoma, Nonpapillary. Among its related pathways are Viral mRNA Translation and Regulation of activated PAK-2p34 by proteasome mediated degradation. Gene Ontology (GO) annotations related to this gene include agmatinase activity. An important paralog of this gene is ARG2.
• Molecular Mass: 37.8 kDa
• AA Sequence: MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AGMAT agmatinase [ Homo sapiens (human) ]
• Official Symbol: AGMAT
• Synonyms: AGMAT; agmatine ureohydrolase (agmatinase); agmatinase, mitochondrial; FLJ23384; AUH
• Gene ID: 79814
• mRNA Refseq: NM_024758
• Protein Refseq: NP_079034
• MIM: 617887
• UniProt ID: Q9BSE5