Recombinant Human AGPAT5 protein, His-tagged

Cat.No. : AGPAT5-4024H
Product Overview : Recombinant Human AGPAT5 protein(139-323 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 139-323 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : IYVKRSAKFNEKEMRNKLQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDCMKNYLDAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVNSKLSIKKTLP
Gene Name AGPAT5 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) [ Homo sapiens ]
Official Symbol AGPAT5
Synonyms AGPAT5; 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon); 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon; FLJ11210; LPAAT e; LPAAT epsilon; 1-AGPAT 5; 1-AGP acyltransferase 5; lysophosphatidic acid acyltransferase epsilon; LPAATE; 1AGPAT5;
Gene ID 55326
mRNA Refseq NM_018361
Protein Refseq NP_060831
UniProt ID Q9NUQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGPAT5 Products

Required fields are marked with *

My Review for All AGPAT5 Products

Required fields are marked with *

0
cart-icon
0
compare icon