Recombinant Human AGPAT9 protein, GST-tagged

Cat.No. : AGPAT9-4641H
Product Overview : Recombinant Human AGPAT9 protein(1-81 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-81 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : LRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Gene Name AGPAT9 1-acylglycerol-3-phosphate O-acyltransferase 9 [ Homo sapiens ]
Official Symbol AGPAT9
Synonyms AGPAT9; 1-acylglycerol-3-phosphate O-acyltransferase 9; 1 acylglycerol 3 phosphate O acyltransferase 9 (lysophosphatidic acid acyltransferase, theta); glycerol-3-phosphate acyltransferase 3; HMFN0839; LPAAT theta; lysophosphatidic acid acyltransferase; theta; MAG1; MGC11324; MAG-1; GPAT-3; hGPAT3; 1-AGPAT 9; 1-AGP acyltransferase 9; endoplasmic reticulum associated GPAT; lung cancer metastasis-associated protein 1; lysophosphatidic acid acyltransferase theta; lysophosphatidic acid acyltransferase, theta; 1-acylglycerol-3-phosphate O-acyltransferase 8; acyl-CoA:glycerol-3-phosphate acyltransferase 3; GPAT3; AGPAT8; LPAAT-theta;
Gene ID 84803
mRNA Refseq NM_001256421
Protein Refseq NP_001243350
MIM 610958
UniProt ID Q53EU6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGPAT9 Products

Required fields are marked with *

My Review for All AGPAT9 Products

Required fields are marked with *

0
cart-icon