Recombinant Human AGPAT9 protein, GST-tagged

• Cat.No.: AGPAT9-4641H
• Product Overview: Recombinant Human AGPAT9 protein(1-81 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-81 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: LRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS

Gene Information

• Gene Name: AGPAT9 1-acylglycerol-3-phosphate O-acyltransferase 9 [ Homo sapiens ]
• Official Symbol: AGPAT9
• Synonyms: AGPAT9; 1-acylglycerol-3-phosphate O-acyltransferase 9; 1 acylglycerol 3 phosphate O acyltransferase 9 (lysophosphatidic acid acyltransferase, theta); glycerol-3-phosphate acyltransferase 3; HMFN0839; LPAAT theta; lysophosphatidic acid acyltransferase; theta; MAG1; MGC11324; MAG-1; GPAT-3; hGPAT3; 1-AGPAT 9; 1-AGP acyltransferase 9; endoplasmic reticulum associated GPAT; lung cancer metastasis-associated protein 1; lysophosphatidic acid acyltransferase theta; lysophosphatidic acid acyltransferase, theta; 1-acylglycerol-3-phosphate O-acyltransferase 8; acyl-CoA:glycerol-3-phosphate acyltransferase 3; GPAT3; AGPAT8; LPAAT-theta
• Gene ID: 84803
• mRNA Refseq: NM_001256421
• Protein Refseq: NP_001243350
• MIM: 610958
• UniProt ID: Q53EU6