Recombinant Human AGPAT9 protein, GST-tagged
Cat.No. : | AGPAT9-4641H |
Product Overview : | Recombinant Human AGPAT9 protein(1-81 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-81 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS |
Gene Name | AGPAT9 1-acylglycerol-3-phosphate O-acyltransferase 9 [ Homo sapiens ] |
Official Symbol | AGPAT9 |
Synonyms | AGPAT9; 1-acylglycerol-3-phosphate O-acyltransferase 9; 1 acylglycerol 3 phosphate O acyltransferase 9 (lysophosphatidic acid acyltransferase, theta); glycerol-3-phosphate acyltransferase 3; HMFN0839; LPAAT theta; lysophosphatidic acid acyltransferase; theta; MAG1; MGC11324; MAG-1; GPAT-3; hGPAT3; 1-AGPAT 9; 1-AGP acyltransferase 9; endoplasmic reticulum associated GPAT; lung cancer metastasis-associated protein 1; lysophosphatidic acid acyltransferase theta; lysophosphatidic acid acyltransferase, theta; 1-acylglycerol-3-phosphate O-acyltransferase 8; acyl-CoA:glycerol-3-phosphate acyltransferase 3; GPAT3; AGPAT8; LPAAT-theta; |
Gene ID | 84803 |
mRNA Refseq | NM_001256421 |
Protein Refseq | NP_001243350 |
MIM | 610958 |
UniProt ID | Q53EU6 |
◆ Recombinant Proteins | ||
AGPAT9-392M | Recombinant Mouse AGPAT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGPAT9-1422M | Recombinant Mouse AGPAT9 Protein | +Inquiry |
AGPAT9-218R | Recombinant Rat AGPAT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGPAT9-791Z | Recombinant Zebrafish AGPAT9 | +Inquiry |
AGPAT9-2442H | Recombinant Human AGPAT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT9 Products
Required fields are marked with *
My Review for All AGPAT9 Products
Required fields are marked with *