Recombinant Human AGPS Protein, GST-tagged
Cat.No. : | AGPS-438H |
Product Overview : | Human AGPS partial ORF ( NP_003650, 559 a.a. - 658 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | FAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGPS alkylglycerone phosphate synthase [ Homo sapiens (human) ] |
Official Symbol | AGPS |
Synonyms | AGPS; alkylglycerone phosphate synthase; ADAS; ADPS; RCDP3; ADAP-S; ADHAPS; ALDHPSY; alkyldihydroxyacetonephosphate synthase, peroxisomal; aging-associated gene 5 protein; aging-associated protein 5; alkyl-DHAP synthase; EC 2.5.1.26; Alkylglycerone Phosphate Synthase; Aging-Associated Gene 5 Protein; Alkyl-DHAP Synthase; Alkyldihydroxyacetonephosphate Synthase, Peroxisomal; Alkylglycerone-Phosphate Synthase; Aging-Associated Protein 5 |
Gene ID | 8540 |
mRNA Refseq | NM_003659 |
Protein Refseq | NP_003650 |
MIM | 603051 |
UniProt ID | O00116 |
◆ Recombinant Proteins | ||
AGPS-563R | Recombinant Rat AGPS Protein | +Inquiry |
AGPS-522H | Recombinant Human AGPS Protein, MYC/DDK-tagged | +Inquiry |
AGPS-438H | Recombinant Human AGPS Protein, GST-tagged | +Inquiry |
AGPS-219R | Recombinant Rat AGPS Protein, His (Fc)-Avi-tagged | +Inquiry |
AGPS-2415H | Recombinant Human AGPS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPS-8973HCL | Recombinant Human AGPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPS Products
Required fields are marked with *
My Review for All AGPS Products
Required fields are marked with *